PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 378aa    MW: 42755.2 Da    PI: 9.2616
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041529.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.8e-2581124144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrg++rsrk++e
  Pbr041529.1  81 DPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSRKPVE 124
                  79***************************************987 PP

2QLQ56.48.8e-201145236
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                 +FT++Q+q+L++Q+l+yKy++++  +Pp+Ll+ ++
  Pbr041529.1 11 PFTPSQWQELEHQALIYKYMVSGISIPPDLLFSLK 45
                 8******************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-111046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.911146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-141143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.15681125IPR014977WRC domain
PfamPF088796.7E-2182124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MNSTGRNSRF PFTPSQWQEL EHQALIYKYM VSGISIPPDL LFSLKRSTYN LDSPLPPKLF  60
SHHPPQIGWN CFQMGLGRKI DPEPGRCRRT DGKKWRCSKE AFPDSKYCER HMHRGKNRSR  120
KPVEVLKTSQ ISTTNSSNTS TITTRINTSS ASPSPAAFHS LSSSLPSLSS SDSHAFPFFY  180
HHNPTSPRPT GIGFPHQERS TTSLFLDSGS YPQPSSDYRN RYAYGMKEEV DEHAFFSEPS  240
GTVRGFSGSS SMDDSWQFTP LTISTSSSSK QRSCSAFQSD QQLQSIKHQK QDHQQQQQQH  300
YYALDSNEGS QKTIHRFFDE WPPKDKDSWL DLDDKSSNSG SVSTTRLSIS IPTSAHDFPI  360
FTSRHHNSKP TSNCIYF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700702e-53KC770070.1 Pyrus pyrifolia microsatellite TXY185 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361693.10.0PREDICTED: growth-regulating factor 1-like isoform X1
TrEMBLM5VX301e-157M5VX30_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0018s07140.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-54growth-regulating factor 5